Am1.6 precursor (N02974) Nucleic Acid Card

General Information
Name Am1.6 precursor
Organism Conus amadis
Organism Diet molluscivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
c
atgggcatgcggatgatgttcaccgtgtttctgttggtt
gtcttggcaaccactgtcgtttccttcacttcatatcgtg
catctgatggcaggaatgccgcagccaaagcgtctgacct
gatcgctctgaccgtccgggattgctgttctcgacctccc
tgtcgctggagtcatccagaactttgtagt
tg
Sequence translation MGMRMMFTVFLLVVLATTVVSFTSYRASDGRNAAAKASDL
IALTVRDCCSRPPCRWSHPELCS

References
Vijayasarathy, M. and Balaram, P. (2019) Cone snail prolyl-4-hydroxylase α-subunit sequences derived from transcriptomic data and mass spectrometric analysis of variable proline hydroxylation in C. amadis venom Journal of proteomics 194:37-48

Internal links
Proteins Encoded Am1.6 precursor

External links
Ncbi
GenBank MH282821

Tools