E5.2 precursor (N02988) Nucleic Acid Card

General Information
Name E5.2 precursor
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism Diet piscivorous
Organism Clade III
Organism Region Eastern Atlantic and Mediterranean,Western Atlantic and Caribbean
Notes

Sequence
cttccggtcttcatcatccttctgctgttggtttcacctg
cagctactctgcctgtggaatctgagctggaaagagactt
gactcaggaatctcctaaagattttgggatgagaactgaa
cactttcctcttatgatttgggtcgactgctgtcctgcgt
acgattgctgtgttccagattctgac
tga
Sequence translation LPVFIILLLLVSPAATLPVESELERDLTQESPKDFGMRTE
HFPLMIWVDCCPAYDCCVPDSD

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Proteins Encoded E5.2 precursor

External links
Ncbi
GenBank MH360462

Tools