Im8.1 precursor (N03052) Nucleic Acid Card

General Information
Name Im8.1 precursor
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
ATGATGTTGAAAATGGGAGCTGTGTTTGCCATTTTGCTTC
TTTTCGCCCTGTCATCCAGCCAGCAGGAAGGAGATGTCCA
GGCAAGGAAAATACGCTTGAGGAACGACTTCCTTCGTACT
TCGAGAATGATTTTCACCCGAGGATGTGGTGGCTCTTGTC
ATACAACCCCCGGTTGTGGCGGTAACTGCGAATGCAATTC
ACCTGTACCGTGTTACTGCAGTGGCACTGAAACATGCGTT
TGTGTTTGTTCAGGCTGA
Sequence translation MMLKMGAVFAILLLFALSSSQQEGDVQARKIRLRNDFLRT
SRMIFTRGCGGSCHTTPGCGGNCECNSPVPCYCSGTETCV
CVCSG-

References
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Proteins Encoded Im8.1 precursor

External links
Ncbi
GenBank KT377424

Tools