Contryphan-Lt1, complete cds (N03209) Nucleic Acid Card

General Information
Name Contryphan-Lt1, complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
ATGGGGAAGCTGACAATTCTGCTTCTTGTTGCTGCTGCAC
TGTTGTCGACCCAGGTCATGGTTCAAGGTGGCGGAGATCA
ACCTGCAGCTCGTAATGCAGTGCCAAGAGACGATAACCCA
GATGGAATGAGTGGACAGTTCATGAATGTTCTACGTCGGT
CTGGATGTCCGTGGGAACCTTGGTGTGGCTGA
Sequence translation MGKLTILLLVAAALLSTQVMVQGGGDQPAARNAVPRDDNP
DGMSGQFMNVLRRSGCPWEPWCG-

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Proteins Encoded Contryphan-Lt1 precursor

External links
Ncbi
GenBank

Tools