Lt7b, cds [partial] (N03270) Nucleic Acid Card

General Information
Name Lt7b, cds [partial]
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
ATGTCGACCCAGGGCCTGATTCAAGAAAAACGCCAAAAGG
CGAAGATCACCATTTTTTCAAAAAGGAAGTCAAATGCTGA
GAGGTGGTGGGAGGGCGATTGCACTGATTGGTTAGGGTCG
TGTTCATCGCCCTCGGAGTGTTGTTATGACAATTGTGAAA
CGTACTGCACGTTGTGGAAATGA
Sequence translation MSTQGLIQEKRQKAKITIFSKRKSNAERWWEGDCTDWLGS
CSSPSECCYDNCETYCTLWK-

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Proteins Encoded Lt7b precursor

External links
Ncbi
GenBank

Tools