Tau-conotoxin peptides (N00447) Nucleic Acid Card

General Information
Name Tau-conotoxin peptides
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgtttcccagtcttcatcattcttctgctgctaa
ttgcatctgcaccttgctttgatgcccgaacgaagaccga
tgatgatgtgcccctgtcatctctccgcgataatctaaag
cgaacgatacgaacacgcctgaacatacgcgagtgctgcg
aggatggatggtgctgtactgctgcacccttaacaggtcg
t
tagggataaaggaaaatggctttggatgagacccctgcg
aattgtccctggatgtgagatttggaaagcagactgttcc
tttcgcacgtgttcgtggaatttcgaatggtcgttaacaa
cacgctgccacttgcaagccaccatctctctgtcctttcg
tatgtggaactgtatgatctaacaactgaaatgtcagaaa
gttttcagtgggtatacactatgatcgtata
Sequence translation MRCFPVFIILLLLIASAPCFDARTKTDDDVPLSSLRDNLK
RTIRTRLNIRECCEDGWCCTAAPLTGR

References
Walker,C., Shetty,R., Olivera,B.M., Hooper,D., Jacobsen,R., Steele,D. and Jones,R.M. (0) Tau-conotoxin peptides

Internal links
Proteins Encoded TxVA precursor

External links
Ncbi
GenBank BD270186

Tools