Sequence 30 from patent US 6630573 (N00475) Nucleic Acid Card

General Information
Name Sequence 30 from patent US 6630573
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgcgctgtttcccagtcttcatcattcttctgctgctaa
ttgcatctgcaccttgctttgatgcccgaacgaagaccga
tgatgatgtgcccctgtcatctctccgcgataatctaaag
cgaacgatacgaacacgcctgaacatacgcgagtgctgcg
aggatggatggtgctgtactgctgcacccttaacaggtcg
t
tagggataaaggaaaatggctttggatgagacccctgcg
aattgtccctggatgtgagatttggaaagcagactgttcc
tttcgcacgtgttcgtggaatttcgaatggtcgttaacaa
cacgctgccacttgcaagccaccatctctctgtcctttcg
tatgtggaactgtatgatctaacaactgaaatgtcagaaa
gttttcagtgggtatacactatgatcgtata
Sequence translation MRCFPVFIILLLLIASAPCFDARTKTDDDVPLSSLRDNLK
RTIRTRLNIRECCEDGWCCTAAPLTGR

References
Walker,C., Shetty,R., Olivera,B.M., Hooper,D., Jacobsen,R., Steele,D. and Jones,R. (2003) Tau-conotoxin peptides Patent: US 6630573 07-OCT-2003

Internal links
Proteins Encoded TxVA precursor

External links
Ncbi
GenBank AR406135

Tools