Conus imperialis mRNA for four-loop conotoxin prepropeptide, clone 3 (N00867) Nucleic Acid Card

General Information
Name Conus imperialis mRNA for four-loop conotoxin prepropeptide, clone 3
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgcatgatgatcgttgctgtgctgttct
tgaccgcctcgatattcatcacggctgataactccagaaa
tggaatcgagaatcttcctcggatgagacgtcacgaaatg
aagaaacccaaagcctctaaattgaacaagagaggctgcc
ttcctgacgaatatttttgtggcttcagtatgattggagc
cctgttgtgctgtagtggttggtgtcttgggatttgcatg
acg
tga
Sequence translation MKLTCMMIVAVLFLTASIFITADNSRNGIENLPRMRRHEM
KKPKASKLNKRGCLPDEYFCGFSMIGALLCCSGWCLGICM
T

References
Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Internal links
Proteins Encoded Im6.8 precursor

External links
Ncbi
GenBank AJ851188

Tools