Conus marmoreus M conotoxin Mr3.8 mRNA, complete cds (N00872) Nucleic Acid Card

General Information
Name Conus marmoreus M conotoxin Mr3.8 mRNA, complete cds
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcatctttctggtcc
tgtttcccctggcaacactgcagctggatgcagatcaacc
tgtagaacgatatgcgaagaacaaacagctcttcaaccca
cataaaaggaggggaatcatattgcgtgctccggggaagc
gatgctgtcattggaattggtgcgaccatctttgttcatg
ctgcggcagt
tagcgccgaacatccatggcgctgtgctgg
gcggttttatccaacaacgacagcgtttgttgatttcatg
tatcattgcgcccacgtctcttgtctaagaatgacgaaca
tgattgcactctggttcagatttcgtgttcttttctgaca
ataaatgacaaaactccaaaaaaaaaaaaaaaa
Sequence translation MLKMGVVLFIFLVLFPLATLQLDADQPVERYAKNKQLFNP
HKRRGIILRAPGKRCCHWNWCDHLCSCCGS

References
Wang,Q., Jiang,H., Han,Y.H., Yuan,D.D. and Chi,C.W. (2008) Two different groups of signal sequence in M-superfamily conotoxins. Toxicon 51:813-822

Internal links
Proteins Encoded Mr3.8 precursor

External links
Ncbi
GenBank AB850748 (partial), AY880684

Tools