Conus imperialis partial mRNA for conotoxin, clone 3 (N00874) Nucleic Acid Card

General Information
Name Conus imperialis partial mRNA for conotoxin, clone 3
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttcgattgacgtcagtcagctgtttcctgctgg
tcatcgcttgtctgaacttggttgtgcttaccaatgcctg
cctccgtgacggacagtcctgcggatatgattccgattgc
tgtagatactcttgctgttgggggtattgcgatcttacgt
gtctaattaatggaaagagggcgacattccaa
Sequence translation MMFRLTSVSCFLLVIACLNLVVLTNACLRDGQSCGYDSDC
CRYSCCWGYCDLTCLINGKRATFQ

References
Kauferstein,S., Huys,I., Kuch,U., Melaun,C., Tytgat,J. and Mebs,D. (2004) Novel conopeptides of the I-superfamily occur in several clades of cone snails Toxicon 44:539-548

Internal links
Proteins Encoded Im11.1 precursor

External links
Ncbi
GenBank AJ746184

Tools