Sequence 30 from patent US 6855805 (N00883) Nucleic Acid Card

General Information
Name Sequence 30 from patent US 6855805
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccttcccttcagatcgtgcatctgatggcaggga
tgacgaagccaaagacgaaaggtctgacatgcacgaatcg
gaccggaaagaaatctgttgcaatcctgcctgtggcccaa
agtatagttgtggacgc
tgatgctccaggaccctctgaac
c
Sequence translation MFTVFLLVVLATTVVSFPSDRASDGRDDEAKDERSDMHES
DRKEICCNPACGPKYSCGR

References
Olivera,B.M., Layer,R.T., McIntosh,J.M., Nielsen,J.S. and Jones,R.M. (2005) Alpha.-conotoxin peptides Patent: US 6855805 15-FEB-2005

Internal links
Proteins Encoded SI precursor

External links
Ncbi
GenBank AR637243

Tools