Conus pennaceus clone PnMKLT1-1111 conotoxin scaffold VI/VII precursor, mRNA, complete cds (N00919) Nucleic Acid Card

General Information
Name Conus pennaceus clone PnMKLT1-1111 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Organism Conus pennaceus
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
ctttggcatcactcaaaacatcaccaag
atgaaactgacg
tgcatgatgatcgttgctgtgctgttcttgaccgcctgga
cagtcgtcacggctgtgcctcactccaacaagcggttggc
gaatctttatctgaaggcacgtcacgaaatgaaaaacccc
gaagcctctaatgtggacaagaggtgctttgagagttggg
tagcttgtgagtctccaaaacgatgctgcagtcacgtgtg
ccttttcgtctgcgcc
tgaaactgccgtgatgtcttctac
tcccctctgtgctacctggcttgatctttgattggcgcgt
gcccttcactggttatgaaccgctctgatccgactctctg
ggggcctcgggggttcaacatccaaataaagtgacatcac
aaaaaaaaaaaaa
Sequence translation MKLTCMMIVAVLFLTAWTVVTAVPHSNKRLANLYLKARHE
MKNPEASNVDKRCFESWVACESPKRCCSHVCLFVCA

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Pn6.12 precursor

External links
Ncbi
GenBank AF193254

Tools