Conus litteratus LeD41P mRNA, complete cds (N00949) Nucleic Acid Card

General Information
Name Conus litteratus LeD41P mRNA, complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
catcgtcaag
atgaaactgacgtgcgtgttgatcatcgcc
gtgctgttcctaacggcctaccaactcactacagttgaga
cttactccagaggtaagtggatgcatcgtgctctcaggtc
aaccggcaaaaaccccaaggtgaccagagaatgctcatct
cccgatgaatcttgtacttaccattataactgctgccagc
tctattgcaataaagaagagaacgtgtgccttgaaaactc
acctgaagtc
tgacattccccttctgtgctctatcctctt
ttgcctgagtcatccatacctgtg
Sequence translation MKLTCVLIIAVLFLTAYQLTTVETYSRGKWMHRALRSTGK
NPKVTRECSSPDESCTYHYNCCQLYCNKEENVCLENSPEV

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S., Zhangsun,D. and Zhang,B. (0) Hainan O-superfamily peptides

Internal links
Proteins Encoded LtVIB precursor

External links
Ncbi
GenBank DQ141148

Tools