Conus miles MiK42P mRNA, complete cds (N00950) Nucleic Acid Card

General Information
Name Conus miles MiK42P mRNA, complete cds
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
catcgtcaag
atgaaactgacgtgcgctttgatcgtcgcc
atgctgctcctgacggcctgtcaactcattacaactgatg
acttcagaggtaggcagcagtatcgtactgcgaggtccag
aaccaagatgcagaattacaagatcttcaggttgaccaag
agatgcgatgcacccaacgccccttgtgagaagtttgaca
atgattgctgcgatgcgtgtatgttacgggaaaagcagca
accaatttgcgcggtt
tgaatagttggtctggcatctgat
cattctccccactgtgctctacgctttttttttgcctgag
tcatccatacctgtg
Sequence translation MKLTCALIVAMLLLTACQLITTDDFRGRQQYRTARSRTKM
QNYKIFRLTKRCDAPNAPCEKFDNDCCDACMLREKQQPIC
AV

References
Luo,S., Zhangsun,D., Feng,J., Wu,Y., Zhu,X. and Hu,Y. (2007) Diversity of the O-superfamily conotoxins from Conus miles J. Pept. Sci. 13:44-53

Internal links
Proteins Encoded MiK42 precursor

External links
Ncbi
GenBank DQ141150

Tools