Conus textile TeA52P mRNA, complete cds (N00952) Nucleic Acid Card

General Information
Name Conus textile TeA52P mRNA, complete cds
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
gaccctgccgtcatctcagcgcagacttggtaagaagtga
aaaacctttatc
atggagaaactgacaatcctgcttcttg
ttgctgctgtactgatgtcgacccaggccctggttgaacg
tgctggagaaaaccactcaaaggagaacatcaaattttta
ttaaaaagaaagagagctgctgacagggggatgtggggcg
aatgcaaagatgggttaacgacatgtttggcgccctcaga
gtgttgttctgaggattgtgaagggagctgcacgatgtgg

tgatgaattctgaccacaagccatctgacatcaccactct
cctcttcagagacttcaaggcta
Sequence translation MEKLTILLLVAAVLMSTQALVERAGENHSKENIKFLLKRK
RAADRGMWGECKDGLTTCLAPSECCSEDCEGSCTMW

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S. and Zhangsun,D. (0) Hainan O-superfamily peptides

Internal links
Proteins Encoded Gla(1)-TxVI precursor

External links
Ncbi
GenBank DQ141152

Tools