Conus textile TeA61P mRNA, complete cds (N00957) Nucleic Acid Card

General Information
Name Conus textile TeA61P mRNA, complete cds
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
cactgtcgtctttcgcatcatccaaaacatcaccaag
atg
aaactgacgtgcatgatgatcgttgctgtgctgttcttga
ccgcctggacattcgccacggctgatgactccagcaatgg
attggggaatctttttttgaaggcacatcacgaaatgaag
aaccccgaagcctctaagttgaacgagaggtgccttgatg
ctggtgaagtttgtgatattttttttccaacatgctgcgg
ctattgcattcttcttttctgcgca
taaaactaccgtgat
gtcttctactcccctctgtgctacctggcttgatctttga
ttggcgcgtacccttcactggttatgaaacccctgatcca
gctctctggaggcctcgggggttcaacatccaaataaagc
gacagcacaa
Sequence translation MKLTCMMIVAVLFLTAWTFATADDSSNGLGNLFLKAHHEM
KNPEASKLNERCLDAGEVCDIFFPTCCGYCILLFCA

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S., Zhangsun,D., Lin,Q., Xie,L., Wu,Y. and Zhu,X. (2006) Sequence diversity of O-superfamily conopetides from Conus marmoreus native to Hainan Peptides 27:3058-3068

Internal links
Proteins Encoded TxO1 precursor

External links
Ncbi
GenBank DQ141160

Tools