Conus capitaneus CaHr91P mRNA, complete cds (N00964) Nucleic Acid Card

General Information
Name Conus capitaneus CaHr91P mRNA, complete cds
Organism Conus capitaneus
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
catcgtcaag
atgaaactgacgtgcgcgttgatcatcacc
gtgctgttcctgagcattacagccgatgactccagaggta
aacaggggtaccgtgcgttgaagtcgattgccggaatgct
gaattccaaaactgtgagggaatgcagggaacaaagtcag
ggttgtactaatactagtcctccttgctgctctggtctcc
gctgtagcggccagagccaaggtggtgtgtgcatctcgaa
c
tgaggactaaatggcgtctgatgtttccctcggcgctct
atcctgtgctgcctgagtcacccacacctctgtgtggtca
tgaaccacgcagtgcctacacctcttggcttcagaggacg
tagatcaaaataaaaccacattgcaaatgaaaataaaaaa
aaaaaaaaa
Sequence translation MKLTCALIITVLFLSITADDSRGKQGYRALKSIAGMLNSK
TVRECREQSQGCTNTSPPCCSGLRCSGQSQGGVCISN

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S. and Zhangsun,D. (0) Hainan O-superfamily peptides

Internal links
Proteins Encoded CaHr91 precursor

External links
Ncbi
GenBank DQ141171

Tools