Conus magus MgJr94P mRNA, complete cds (N00967) Nucleic Acid Card

General Information
Name Conus magus MgJr94P mRNA, complete cds
Organism Conus magus (Magus cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
catcgtcaag
atgaaactgacgtgcgtgctgatcgtcgtc
gtgctgttcctgacggcctgtcaactcattccagcagatt
actccagagatactccggggtatcctgcttggaagttgaa
aaccaagatgcagaattccaggcgctggaagttggccaag
agatgcaaggggaaaggcgctggctgtgattattctcatg
agtgctgcagtcgccaatgtacaggtagaatttttcaaac
ttgcaat
taaacctggcgtctgattctttccctctgtgct
ctaccttcttttgcctagttcatcatccatagccctgagt
ggtcatgacccacgcggtatggactccaatggtggattca
gagaacatgtatttaaataaaaccacattgcaatgacaaa
aaaaaaaaaaaaaa
Sequence translation MKLTCVLIVVVLFLTACQLIPADYSRDTPGYPAWKLKTKM
QNSRRWKLAKRCKGKGAGCDYSHECCSRQCTGRIFQTCN

References
Luo,S., Zhangsun,D., Zhang,B. and Lin,Q. (0) Novel O-superfamily conotoxins, and their coding polynucleotides and use
Luo,S. and Zhangsun,D. (0) Hainan O-superfamily peptides

Internal links
Proteins Encoded MgJr94 precursor

External links
Ncbi
GenBank DQ141174

Tools