Ba12.1 (P10062) Protein Card

General Information
Name Ba12.1 (named by ConoServer)
Organism Conus bayani
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ba12.1 precursor (10063)
Notes Predicted by ConoServer from protein precursor.

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework XII
Pharmacological family

Sequence
VTNKCGPKPVAECWWDDECKGWSNYCGQSPEECCSADCAFY
CKLW
Sequence evidence nucleic acid level
Average Mass 5133.70
Monoisotopic Mass 5130.01
Isoelectric Point 5.22
Extinction Coefficient [280nm] 24980.00

References
Rajaian Pushpabai,R., Wilson Alphonse,C.R., Mani,R., Arun Apte,D. and Franklin,J.B. (2021) Diversity of Conopeptides and Conoenzymes from the Venom Duct of the Marine Cone Snail Conus bayani as Determined from Transcriptomic and Proteomic Analyses. Mar Drugs 19

Internal links
Protein Precursor Ba12.1 precursor (10063)
Nucleic acids
Structure

External links

Tools