Conotoxin-2 precursor (P01059) Protein Card

General Information

Name	Conotoxin-2 precursor
Organism	Conus striatus (Striated cone)
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Precursor
Notes	The signal sequence delimitation is according Kauferstein et al. and differs from the Swiss-Prot annotation.

Classification

Conopeptide class	conotoxin
Gene superfamily	O1 superfamily
Pharmacological family

Sequence

MKLTCVVIVAVLLLTACQLITADDS RGTQKHRSLRSTTKVS K AADCIEAGNYCGPTVMKLCCGFCSPYSKICMNYPKN
Sequence region	[1-25] signal sequence [43-78] mature peptide Conotoxin-2

References

Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Internal links

Nucleic acids	Conus striatus mRNA for four-loop conotoxin preproprotein, clone 2
Structure

External links

UniProtKB/Swiss-Prot	Q5K0D8
Ncbi	Q5K0D8, CAH64843

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 27 March 2023