Im6.8 precursor (P01077) Protein Card

General Information

Name	Im6.8 precursor (named by ConoServer)
Alternative name(s)	Conotoxin-3 precursor,Im017O1_1
Organism	Conus imperialis
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	O1 superfamily
Cysteine framework	VI/VII
Pharmacological family

Sequence

MKLTCMMIVAVLFLTASIFITA DNSRNGIENLPRMRRHEMK KPKASKLNKR GCLPDEYFCGFSMIGALLCCSGWCLGICMT
Sequence evidence	nucleic acid level
Sequence region	[1-22] signal sequence [52-81] mature peptide Im6.8

References

Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367

Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links

Nucleic acids	Conus imperialis mRNA for four-loop conotoxin prepropeptide, clone 3 Im6.8 precursor
Structure

External links

UniProtKB/Swiss-Prot	Q5K0C0
Ncbi	CAH64861, Q5K0C0

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Saturday 25 March 2023