RVIIA precursor (P01495) Protein Card

General Information

Name	RVIIA precursor
Organism	Conus radiatus
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	O1 superfamily
Pharmacological family

Sequence

APAKR WFGHEECTYWLGPCEVDDTCCSASCESKFCGLW
Sequence region	[6-38] mature peptide RVIIA

References

Jimenez,E.C., Watkins,M. and Olivera,B.M. (2004) Multiple 6-bromotryptophan residues in a sleep-inducing peptide Biochemistry 43:12343-12348

Internal links

Nucleic acids
Structure

External links

UniProtKB/Swiss-Prot	P0C1M8
Ncbi	P0C1M8

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Sunday 24 September 2023