PnVIA (P01742) Protein Card

General Information

Name	PnVIA
Alternative name(s)	Pn6a
Organism	Conus pennaceus
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Wild type
Protein precursor	PnVIA precursor (1091)

Classification

Conopeptide class	conotoxin
Gene superfamily	O1 superfamily
Cysteine framework	VI/VII
Pharmacological family	omega conotoxin

Sequence

GCLEVDYFCGIPFANNGLCCSGNCVFVCTPQ
Sequence evidence	protein level
Average Mass	3268.72
Monoisotopic Mass	3266.31
Isoelectric Point	3.17
Extinction Coefficient [280nm]	1490.00

References

Kits,K.S., Lodder,J.C., van der Schors,R.C., Li,K.W., Geraerts,W.P. and Fainzilber,M. (1996) Novel omega-conotoxins block dihydropyridine-insensitive high voltage-activated calcium channels in molluscan neurons J. Neurochem. 67:2155-2163

Internal links

Protein Precursor	PnVIA precursor (1091)
Nucleic acids
Structure

External links

UniProtKB/Swiss-Prot	P56712
Ncbi	P56712

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 5 December 2023