Sequence 80 from patent US 6727226 (P01807) Protein Card

General Information
Name Sequence 80 from patent US 6727226
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MMSKLGVLLTICLLLFPLTAVPLDGDQPADRPAERMQDGIS
SEHHPFFDSVKKKQQCCPPVACNMGCEPCCG
Average Mass 7820.20
Monoisotopic Mass 7814.70
Isoelectric Point NA
Extinction Coefficient [280nm] 875.00

References
Olivera,B.M., McIntosh,J.M., Garrett,J.E., Cruz,L.J., Jones,R.M., Cartier,G.E. and Wagstaff,J.D. (2004) Mu-conopeptides Patent: US 6727226-A 80 27-APR-2004; University of Utah Research Foundation and Cognetix, Inc.; Salt Lake City, UT

Internal links
Nucleic acids
Structure

External links
Patent Lens US6727226
Ncbi AAU97939

Tools