Sequence 18 from patent US 6767896 (P02154) Protein Card

General Information
Name Sequence 18 from patent US 6767896
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MRCLPVFVILLLLTASAPSVDAKVHLKTKGDGPLSSFRDNA
KSTLQRLQDKSTCCGFKMCIPC
Average Mass 6855.21
Monoisotopic Mass 6850.55
Isoelectric Point NA
Extinction Coefficient [280nm] 625.00

References
McIntosh,J.M., Olivera,B.M., Cruz,L.J., Corpuz,G.P., Jones,R.M. and Garrett,J.E. (2004) Conotoxin peptides Patent: US 6767896 27-JUL-2004

Internal links
Nucleic acids
Structure

External links
Patent Lens US6767896
Ncbi AAV25694

Tools