Sequence 41 from patent US 6630573 (P02198) Protein Card

General Information
Name Sequence 41 from patent US 6630573
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MRCLPVFIILLLLIASAPGVDAQPKTKYNAPLTSLHDNAKG
ILQEHWNKRCCPRRLACCIIGRK
Average Mass 7170.67
Monoisotopic Mass 7165.86
Isoelectric Point NA
Extinction Coefficient [280nm] 7615.00

References
Walker,C., Shetty,R., Olivera,B.M., Hooper,D., Jacobsen,R., Steele,D. and Jones,R. (2003) Tau-conotoxin peptides Patent: US 6630573 07-OCT-2003

Internal links
Nucleic acids
Structure

External links
Patent Lens US6630573
Ncbi AAR66028

Tools