Sequence 29 from patent US 6630573 (P02204) Protein Card

General Information

Name	Sequence 29 from patent US 6630573
Organism	Unknown
Protein Type	Patent

Classification

Conopeptide class	conotoxin
Gene superfamily
Pharmacological family

Sequence

MCCLPVFVILLLLITSAPSVDALPKTRDDVPLASFHGGYNA RRILQRRQGWCCKENIACCV
Average Mass	6777.10
Monoisotopic Mass	6772.47
Isoelectric Point	NA
Extinction Coefficient [280nm]	7740.00

References

Walker,C., Shetty,R., Olivera,B.M., Hooper,D., Jacobsen,R., Steele,D. and Jones,R. (2003) Tau-conotoxin peptides Patent: US 6630573 07-OCT-2003

Internal links

Nucleic acids
Structure

External links

Patent Lens	US6630573
Ncbi	AAR66022

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Sunday 11 June 2023