Sequence 121 from patent US 6797808 (P00222) Protein Card

General Information
Name Sequence 121 from patent US 6797808
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MFTVFLLVVLATTVVSFPSDRASDGRNAAASDRASDAAHQG
CCSNPVCHVEHPELCRRRR
Average Mass 6529.39
Monoisotopic Mass 6525.16
Isoelectric Point 8.15
Extinction Coefficient [280nm] 500.00

References
Watkins,M., Olivera,B.M., Hillyard,D.R., McIntosh,J.M. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Nucleic acids
Structure

External links
Patent Lens US6797808
Ncbi AAW06062

Tools