Sequence 5 from patent US 5482928 (P02477) Protein Card

General Information

Name	Sequence 5 from patent US 5482928
Organism	Unknown
Protein Type	Patent

Classification

Conopeptide class	conotoxin
Gene superfamily
Pharmacological family

Sequence

ACSGRGSRCPPQCCMGLRCGRGNPQKCIGAHEDV
Average Mass	3548.09
Monoisotopic Mass	3545.56
Isoelectric Point	NA
Extinction Coefficient [280nm]	750.00

References

De Bolle,M., Broekaert,W.F., Cammue,B.P.A., Rees,S.B. and Vanderleyden,J. (1996) Biocidal proteins Patent: US 5482928-A 5 09-JAN-1996;

Internal links

Nucleic acids
Structure

External links

Patent Lens	US5482928
Ncbi	AAA95625

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Wednesday 22 March 2023