Ac4.3a (P02489) Protein Card

General Information

Name	Ac4.3a
Organism	Conus achatinus
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Ac4.3a precursor (564)

Classification

Conopeptide class	conotoxin
Gene superfamily	A superfamily
Cysteine framework	IV
Pharmacological family

Sequence

QKELVVTATTTCCGYNPMTSCPRCMCDSSCNKKKK(nh2)
Modified residues	position symbol name 36 nh2 C-term amidation
Sequence evidence	nucleic acid level
Average Mass	3853.51
Monoisotopic Mass	3850.69
Isoelectric Point	10.94
Extinction Coefficient [280nm]	1490.00

References

Yuan,D.D., Han,Y.H., Wang,C.G. and Chi,C.W. (2007) From the identification of gene organization of alpha conotoxins to the cloning of novel toxins Toxicon 49:1135-1149

Internal links

Protein Precursor	Ac4.3a precursor (564)
Nucleic acids
Structure

External links

Ncbi

ABD33866

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 26 September 2023