Im6.8 (P02648) Protein Card

General Information
Name Im6.8 (named by ConoServer)
Alternative name(s) Conotoxin-3
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im6.8 precursor (1077)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
GCLPDEYFCGFSMIGALLCCSGWCLGICMT
Sequence evidence protein level
Average Mass 3188.79
Monoisotopic Mass 3186.26
Isoelectric Point 4.50
Extinction Coefficient [280nm] 6990.00

References
Kauferstein,S., Melaun,C. and Mebs,D. (2005) Direct cDNA cloning of novel conopeptide precursors of the O-superfamily Peptides 26:361-367
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Protein Precursor Im6.8 precursor (1077)
Nucleic acids
Structure

External links
Ncbi CAH64861, Q5K0C0

Tools