LiCr173 precursor (P02722) Protein Card

General Information
Name LiCr173 precursor
Organism Conus lividus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSGLGTMVLTLLLLVFMVTSHQDGG
KKQATQRNAVNIRRRK
SITQR
TTDEKCNEYCEERDRNCCGKANGEPRCARMCF
G
Sequence region
[1-25]signal sequence
[47-78]mature peptideLiCr173

References
Zhangsun, D., Luo, S., Wu, Y., Zhu, X., Hu, Y. and Xie, L. (2006) Novel O-superfamily conotoxins identified by cDNA cloning from three vermivorous Conus species. Chem Biol Drug Des. 68:256-265

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot Q3YED3
Ncbi Q3YED3, AAZ83779

Tools