Pu1.4 (P02864) Protein Card

General Information
Name Pu1.4
Organism Conus pulicarius
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Pu1.4 precursor (2863)

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework I
Pharmacological family

Sequence
NAWFTPEECCAAPACRGMILEFCLAGEAFAAALDGFRRLPY
R
Sequence evidence nucleic acid level
Average Mass 4635.35
Monoisotopic Mass 4632.14
Isoelectric Point 5.10
Extinction Coefficient [280nm] 6990.00

References
Biggs,J.S., Olivera,B.M. and Kantor,Y.I. (2008) alpha-Conopeptides specifically expressed in the salivary gland of Conus pulicarius. Toxicon 52:101-105

Internal links
Protein Precursor Pu1.4 precursor (2863)
Nucleic acids
Structure

External links

Tools