Sequence 256 from patent US 6797808 (P00329) Protein Card

General Information

Name	Sequence 256 from patent US 6797808
Organism	Unknown
Protein Type	Patent

Classification

Conopeptide class	conotoxin
Gene superfamily
Pharmacological family

Sequence

SDGRNIAVDDRWSFYTLFHATCCADPDCRFRPGC
Average Mass	3896.32
Monoisotopic Mass	3893.69
Isoelectric Point	6.02
Extinction Coefficient [280nm]	7490.00

References

Watkins,M., Olivera,B.M., Hillyard,D.R., McIntosh,J.M. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links

Nucleic acids
Structure

External links

Patent Lens	US6797808
Ncbi	AAW06169

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 21 March 2023