LtVIA (P03334) Protein Card

General Information
Name LtVIA
Alternative name(s) Lt037
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor LtVIA precursor (1154)
LtVIA precursor (9817)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DAMQKSKGSGSCAYISEPCDILPCCPGLKCNEDFVPICL
Sequence evidence nucleic acid level
Average Mass 4130.77
Monoisotopic Mass 4127.79
Isoelectric Point 5.08
Extinction Coefficient [280nm] 1490.00

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Protein Precursor LtVIA precursor (1154)
LtVIA precursor (9817)
Nucleic acids
Structure

External links

Tools