Lt6d/Lt6e (P03335) Protein Card

General Information
Name Lt6d/Lt6e
Alternative name(s) Lt039
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt6e precursor (1158)
Lt6d precursor (1157)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CTDEGGDCDPGNHNCCRGSCLVLQHKAVCGILYTMVS
Sequence evidence nucleic acid level
Average Mass 3894.38
Monoisotopic Mass 3891.60
Isoelectric Point 6.38
Extinction Coefficient [280nm] 1490.00

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819
Zhang, H., Fu, Y., Wang, L., Liang, A., Chen, S. and Xu, A. (2019) Identifying novel conopepetides from the venom ducts of Conus litteratus through integrating transcriptomics and proteomics Journal of proteomics 192:346-357
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Protein Precursor Lt6e precursor (1158)
Lt6d precursor (1157)
Nucleic acids
Structure

External links

Tools