Sequence 146 from Patent EP1852440. (P03486) Protein Card

General Information

Name	Sequence 146 from Patent EP1852440.
Organism	Conus bullatus
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Patent

Classification

Conopeptide class	conotoxin
Gene superfamily
Pharmacological family

Sequence

MFTVFLLVVLTTTVVSFPSDRASDGRNAAANDKASDVVTLV LKGCCSTPPCAVLYCGRRR
Average Mass	6394.47
Monoisotopic Mass	6390.26
Isoelectric Point	8.86
Extinction Coefficient [280nm]	1990.00

References

Watkins, M., Hillyard, D.R., McIntosh, M.J., Jones, R.M. and Olivera, B.M. (2007) Alpha-conotoxin peptides Patent: EP 1852440-A 07-NOV-2007; University of Utah Research Foundation (US);

Internal links

Nucleic acids	Sequence 146 from Patent EP1852440.
Structure

External links

Ncbi

CAR81559

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Friday 31 March 2023