Cp20.2 (P03589) Protein Card

General Information
Name Cp20.2
Organism Conus capitaneus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Cp20.2 precursor (3588)
Notes Framework: This framework was assigned to be XII on discovery of VxXIIA , VxXIIB and VxXIIC 2006, which also had been used for conotoxins from the I superfamily (Brown et al. 2005). Loughnan et al. now propose framework designation XX (see reference).

Dimers: Mature D superfamily peptides form hetero-, homo- and pseudohomodimers (identical sequence, different posttranslational modifications). Entries for mature peptides in ConoServer are for monomers.

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XX
Pharmacological family

Sequence
DVR(Gla)CQVDTPGSSWGKCCMTRMCGTMCCSRSVCTCVY
HWRRGHGCSCPG
Modified residues
positionsymbolname
4GlaGamma carboxylic glutamic acid
Sequence evidence nucleic acid level
Average Mass 5456.20
Monoisotopic Mass 5452.09
Isoelectric Point 11.42
Extinction Coefficient [280nm] 12490.00

References
Loughnan,M.L., Nicke,A., Lawrence,N. and Lewis,R.J. (2009) Novel alphaD-conopeptides and their precursors identified by cDNA cloning define the D-conotoxin superfamily. Biochemistry 48:3717-3729

Internal links
Protein Precursor Cp20.2 precursor (3588)
Nucleic acids
Structure

External links

Tools