VxXXA precursor (P03630) Protein Card

General Information

Name	VxXXA precursor
Alternative name(s)	Vx98 precursor
Organism	Conus vexillum
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	D superfamily
Pharmacological family

Sequence

MPKLEMMLLVLLIFPLSYFIAAGG QVVQVDRRGDGLAGYLQ RGDR DVQDCQVSTPGSKWGRCCLNRVCGPMCCPASHCYCVY HRGRGHGCSC
Sequence evidence	nucleic acid level
Sequence region	[1-24] signal sequence [46-92] mature peptide VxXXA

References

Loughnan,M.L., Nicke,A., Lawrence,N. and Lewis,R.J. (2009) Novel alphaD-conopeptides and their precursors identified by cDNA cloning define the D-conotoxin superfamily. Biochemistry 48:3717-3729

Prashanth,J.R., Dutertre,S., Jin,A.H., Lavergne,V., Hamilton,B., Cardoso,F.C., Griffin,J., Venter,D.J., Alewood,P.F. and Lewis,R.J. (2016) The role of defensive ecological interactions in the evolution of conotoxins. Mol. Ecol. 25:598-615

Internal links

Nucleic acids	VxXXA cDNA
Structure

External links

UniProtKB/Swiss-Prot	C4PWC1
Ncbi	CAX51119

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 26 September 2023