Eu5 precursor (P03856) Protein Card

General Information
Name Eu5 precursor (named by ConoServer)
Alternative name(s) Eb5
Organism Conus eburneus
Organism diet generalist
Protein Type Precursor
Notes This peptide, extracted from Conus eburneus, was originally published under the name "Eb5" but the abbreviation "Eb" was already in used for peptides extracted from Conus ebraeus. Therefore the peptide was rename "Eu5".

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MSKLGVVLLIFVVLLALTS
PHHYGNRFAGYQARQMGVQQRK
NALANAVRRS
GCGYLGEPCCISPKRAYCHGDLECNNVAMCV
N
Sequence evidence nucleic acid level
Sequence region
[1-19]signal sequence
[52-83]mature peptideEu5

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Nucleic acids Conus eburneus clone Eb5 M superfamily conotoxin mRNA, completecds.
Structure

External links
Ncbi ACV87167

Tools