Eu5 (P03872) Protein Card

General Information
Name Eu5
Alternative name(s) Eb5
Organism Conus eburneus
Organism diet generalist
Protein Type Wild type
Protein precursor Eu5 precursor (3856)
Notes This peptide, extracted from Conus eburneus, was originally published under the name "Eb5" but the abbreviation "Eb" was already in used for peptides extracted from Conus ebraeus. Therefore the peptide was rename "Eu5". This framework is new and has not yet been named.

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
GCGYLGEPCCISPKRAYCHGDLECNNVAMCVN
Sequence evidence nucleic acid level
Average Mass 3414.89
Monoisotopic Mass 3412.37
Isoelectric Point 6.85
Extinction Coefficient [280nm] 2980.00

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Protein Precursor Eu5 precursor (3856)
Nucleic acids
Structure

External links

Tools