Conkunitzin-Cal9.1d precursor (P03965) Protein Card

General Information

Name	Conkunitzin-Cal9.1d precursor
Organism	Conus californicus
Organism region	Eastern Pacific
Organism diet	piscivorous
Protein Type	Precursor

Classification

Conopeptide class	conkunitzin
Gene superfamily
Pharmacological family

Sequence

RTKR DVCELPFEEGPCFAAIRVYAYNAKTGDCEQLTYGGCE GNGNRFATLEDCDNACARY
Sequence region	[5-60] mature peptide Conkunitzin-Cal9.1d

References

Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links

Nucleic acids	Cal 9.1d precursor
Structure

External links

UniProtKB/Swiss-Prot	D2Y491
Ncbi	ADB04234, D2Y491

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 27 March 2023