Cal6.16 (P04032) Protein Card

General Information

Name	Cal6.16
Organism	Conus californicus
Organism region	Eastern Pacific
Organism diet	piscivorous
Protein Type	Wild type

Classification

Conopeptide class	conotoxin
Gene superfamily
Cysteine framework	VI/VII
Pharmacological family

Sequence

QWPFQQWAPCTGHWDCPGDRCCFAGYCLETTPSCD
Average Mass	4004.39
Monoisotopic Mass	4001.52
Isoelectric Point	4.95
Extinction Coefficient [280nm]	17990.00

References

Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links

Nucleic acids	Cal6.16
Structure

External links

UniProtKB/Swiss-Prot	D6C4K6
Ncbi	ADB93118, D6C4K6

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Sunday 26 March 2023