C4.1b (P04082) Protein Card

General Information

Name	C4.1b
Alternative name(s)	Ca046
Organism	Conus catus
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	C4.1b precursor (3925)

Classification

Conopeptide class	conotoxin
Gene superfamily	A superfamily
Cysteine framework	IV
Pharmacological family

Sequence

QKELVPSTITTCCGHEPGTMCPKCMCDNTCPPKKKKRP
Sequence evidence	nucleic acid level
Average Mass	4185.96
Monoisotopic Mass	4182.91
Isoelectric Point	11.09
Extinction Coefficient [280nm]	-1.00

References

Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Himaya, S.W.A., Jin, A.H., Dutertre, S., Giacomotto, J., Mohialdeen, H., Vetter, I., Alewood, P.F. and Lewis, R.J. (2015) Comparative venomics reveals the complex prey capture strategy of the piscivorous cone snail Conus catus. Journal of proteome research 14:4372-4381

Internal links

Protein Precursor	C4.1b precursor (3925)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Thursday 1 June 2023