Cal9.2a (P04141) Protein Card

General Information

Name	Cal9.2a
Organism	Conus californicus
Organism region	Eastern Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Cal9.2a precursor (3989)

Classification

Conopeptide class	conotoxin
Gene superfamily	Divergent M---L-LTVA
Cysteine framework	IX
Pharmacological family

Sequence

ZDDGFPCNAGNCACLPLDSYSYTCQSPTSSTANCEGNECVS EADW
Modified residues	position symbol name 1 Z Pyroglutamic acid
Sequence evidence	nucleic acid level
Average Mass	4731.93
Monoisotopic Mass	4728.73
Isoelectric Point	NA
Extinction Coefficient [280nm]	NA

References

Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links

Protein Precursor	Cal9.2a precursor (3989)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Sunday 28 May 2023