Vc6.7 precursor (P04268) Protein Card

General Information

Name	Vc6.7 precursor
Organism	Conus victoriae
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	O2 superfamily
Pharmacological family

Sequence

MEKLTILLLVAAVLMSIQAVNQ EKHQRAKMNLLSKRKPPAE RWWR WGGCMAWFGLCSKDSECCSNSCDVTRCELMPFPPDW
Sequence region	[1-22] signal sequence [46-81] mature peptide Vc6.7

References

Safavi-Hemami,H., Siero,W.A., Kuang,Z., Williamson,N.A., Karas,J.A., Page,L.R., MacMillan,D., Callaghan,B., Kompella,S.N., Adams,D.J., Norton,R.S., and Purcell,A.W. (2011) Embryonic toxin expression in the cone snail Conus victoriae: primed to kill or divergent function? J. Biol. Chem. 286:22546-22557

Internal links

Nucleic acids	Conus victoriae O-conotoxin Vc6.7 precursor, mRNA, complete cds.
Structure

External links

UniProtKB/Swiss-Prot	G1AS73
Ncbi	AEA35356

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 5 December 2023