Eu6.6 (P04636) Protein Card

General Information
Name Eu6.6
Alternative name(s) Eb6.6
Organism Conus eburneus
Organism diet generalist
Protein Type Wild type
Protein precursor Eu6.6 precursor (4572)
Notes This peptide, extracted from Conus eburneus, was originally published under the name "Eb6.6" but the abbreviation "Eb" was already in used for peptides extracted from Conus ebraeus. Therefore the peptide was renamed "Eu6.6".

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
TCSSPSNCPTGQECCPDKVDEPEGFCADECIIT
Sequence evidence nucleic acid level
Average Mass 3473.75
Monoisotopic Mass 3471.30
Isoelectric Point 3.75
Extinction Coefficient [280nm] -1.00

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Protein Precursor Eu6.6 precursor (4572)
Nucleic acids
Structure

External links

Tools