Lt28.1 (P04652) Protein Card

General Information
Name Lt28.1
Alternative name(s) Lt15.2
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt28.1 precursor (4540)
Notes Lu et al 2017 reported that Lt28.1 can be expressed in yeast Pichia pastoris. This recombinant Lt28.1 had no obvious binding activity on α7, α4β4, α2β2, α2β4, α3β4 and α6α3β2β3 nAChRs subtypes, and weakly acted on α3β2 and α4β2 nAChRs subtypes, showing an inhibition ratio of 19.4% and 18% at 10 μM.

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XXVIII
Pharmacological family

Sequence
LHCHEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPACTC
PPCL
Sequence evidence nucleic acid level
Average Mass 4681.39
Monoisotopic Mass 4677.88
Isoelectric Point 4.68
Extinction Coefficient [280nm] 5500.00

References
Lu, J., Zhang, K., Wang, S., Sun, T., Yu, S., Dai, Q. and Liu, Z. (2017) Cloning, expression and functional characterization of a D-superfamily conotoxin Lt28. 1 with previously undescribed cysteine pattern Peptides, 94, pp.64-70 94:64-70

Internal links
Protein Precursor Lt28.1 precursor (4540)
Nucleic acids
Structure

External links

Tools