Lt28.4 (P04657) Protein Card

General Information

Name	Lt28.4
Alternative name(s)	Lt15.9
Organism	Conus litteratus
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	Lt28.4 precursor (4543)

Classification

Conopeptide class	conotoxin
Gene superfamily	D superfamily
Cysteine framework	XXVIII
Pharmacological family

Sequence

LHCHEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGTACTC PPCL
Sequence evidence	nucleic acid level
Average Mass	4685.37
Monoisotopic Mass	4681.88
Isoelectric Point	4.68
Extinction Coefficient [280nm]	5500.00

References

Lu, J., Zhang, K., Wang, S., Sun, T., Yu, S., Dai, Q. and Liu, Z. (2017) Cloning, expression and functional characterization of a D-superfamily conotoxin Lt28. 1 with previously undescribed cysteine pattern Peptides, 94, pp.64-70 94:64-70

Internal links

Protein Precursor	Lt28.4 precursor (4543)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Wednesday 27 September 2023