Mr23a (P05340) Protein Card

General Information

Name	Mr23a
Organism	Conus marmoreus
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Wild type
Protein precursor	Mr23a precursor (5216)
Notes	Predicted by ConoServer from protein precursor

Classification

Conopeptide class	conotoxin
Gene superfamily
Cysteine framework	XXIII
Pharmacological family

Sequence

IPYCGQTGAECYSWCIKQDLSKDWCCDFVKDIRMNPPADKC P
Sequence evidence	nucleic acid level
Average Mass	4823.51
Monoisotopic Mass	4820.07
Isoelectric Point	6.45
Extinction Coefficient [280nm]	13980.00

References

Ye,M., Khoo,K.K., Xu,S., Zhou,M., Boonyalai,N., Perugini,M.A., Chi,C., Galea,C.A., Wang,C. and Norton,R.S. (2012) A Helical Conotoxin From Conus Imperialis Has A Novel Cysteine Framework And Defiines A New Superfamily J Biol Chem 287:14973-14983

Internal links

Protein Precursor	Mr23a precursor (5216)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 21 March 2023